PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0010200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 299aa    MW: 32649.9 Da    PI: 6.7771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0010200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd++++ G g+W++ +r  g++R++k+c++rw +yl
  Spipo11G0010200 14 KGPWTPEEDRKLVDYIEKNGHGSWRALPRQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.81e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+ l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Spipo11G0010200  67 RGKFSEEEERLIIHLHSILGNK-WSAIATKLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129419.016961IPR017930Myb domain
SuperFamilySSF466899.87E-3211108IPR009057Homeodomain-like
SMARTSM007176.5E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001674.69E-121661No hitNo description
PROSITE profilePS5129428.16862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2665116IPR009057Homeodomain-like
SMARTSM007172.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.5E-1667112IPR001005SANT/Myb domain
CDDcd001678.98E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRPPCCKDD GLKKGPWTPE EDRKLVDYIE KNGHGSWRAL PRQAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEERLIIH LHSILGNKWS AIATKLPGRT DNEIKNYWNT HLRKQLFRMG  120
IDPVTHRPRA DLALLANFPT LLATTDLGCS PAAEQIAGLQ LVLQGVVQAL LATAVSPPSP  180
RNIDLRSLLD KSPEFQSSFT AGELLGSGHY LPNLVAADPS VAAIGDIQPQ SPYSNPTGTA  240
TTSLASSDSP ENATSELFQD MINPAAEAVA NSASAGAFQP WRYFPETGSD YCWEDILG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240896.13e-90PREDICTED: transcription factor MYB39-like
RefseqXP_010240897.13e-90PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A061EYD84e-87A0A061EYD8_THECC; Myb domain protein 107
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.26e-84myb domain protein 9